Anti-PHD1/prolyl hydroxylase + PHD2/prolyl hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8587-100
| Article Name: |
Anti-PHD1/prolyl hydroxylase + PHD2/prolyl hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A8587-100 |
| Supplier Catalog Number: |
A8587-100 |
| Alternative Catalog Number: |
ABC-A8587-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to PHD1/prolyl hydroxylase + PHD2/prolyl hydroxylase. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
44 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
DIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK |
| Target: |
PHD1/prolyl hydroxylase + PHD2/prolyl hydroxylase |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000 |
