Anti-CHRND Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8623-100
Article Name: Anti-CHRND Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8623-100
Supplier Catalog Number: A8623-100
Alternative Catalog Number: ABC-A8623-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human CHRND (NP_000742.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CHRND.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 59 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRK
Target: CHRND
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000