Anti-VPAC1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A8638-100
Article Name: Anti-VPAC1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A8638-100
Supplier Catalog Number: A8638-100
Alternative Catalog Number: ABC-A8638-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human VIPR1 (NP_004615.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to VPAC1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 51 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY
Target: VPAC1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200