Anti-COL11A1 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A8650-100
| Article Name: |
Anti-COL11A1 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A8650-100 |
| Supplier Catalog Number: |
A8650-100 |
| Alternative Catalog Number: |
ABC-A8650-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 260-430 of human COL11A1 (NP_542196.2). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to COL11A1. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
252 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING |
| Target: |
COL11A1 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
IHC: 1:50-1:200 |
