Anti-SFRS14/SUGP2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88171-100
Article Name: Anti-SFRS14/SUGP2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88171-100
Supplier Catalog Number: A88171-100
Alternative Catalog Number: ABC-A88171-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human SUGP2 (NP_055699.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SFRS14/SUGP2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 131 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: EAVGLQDIAPSPAAFPNFEDSTLFGREYIDHLKAWLVSSGCPLQVKKAEPEPMREEEKMIPPTKPEIQAKAPSSLSDAVPQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKLLPWQRRGLLRAQGLRGWKARRATTGT
Target: SFRS14/SUGP2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000