Anti-PHKA1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88192-100
Article Name: Anti-PHKA1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88192-100
Supplier Catalog Number: A88192-100
Alternative Catalog Number: ABC-A88192-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-820 of human PHKA1 (NP_001116142.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PHKA1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 137 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: QTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEI
Target: PHKA1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000