Anti-HMGA1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88672-100
Article Name: Anti-HMGA1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88672-100
Supplier Catalog Number: A88672-100
Alternative Catalog Number: ABC-A88672-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to HMGA1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 20 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
Target: HMGA1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200