Anti-Proteasome Activator Subunit 4/PSME4 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88730-100
Article Name: Anti-Proteasome Activator Subunit 4/PSME4 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88730-100
Supplier Catalog Number: A88730-100
Alternative Catalog Number: ABC-A88730-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1634-1843 of human PSME4 (NP_055429.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Proteasome Activator Subunit 4/PSME4.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 211 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
Target: Proteasome Activator Subunit 4/PSME4
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200