Anti-Ephrin B1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89569-100
Article Name: Anti-Ephrin B1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89569-100
Supplier Catalog Number: A89569-100
Alternative Catalog Number: ABC-A89569-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 259-346 of human Ephrin B1.
Conjugation: Unconjugated
Rabbit polyclonal antibody to Ephrin B1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Target: Ephrin B1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000