Anti-SPRY2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89591-100
Article Name: Anti-SPRY2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89591-100
Supplier Catalog Number: A89591-100
Alternative Catalog Number: ABC-A89591-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to amino acids 1-100 of human SPRY2.
Conjugation: Unconjugated
Rabbit polyclonal antibody to SPRY2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVH
Target: SPRY2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC-P: 1:50-1:200