Anti-NSUN3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89611-100
Article Name: Anti-NSUN3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89611-100
Supplier Catalog Number: A89611-100
Alternative Catalog Number: ABC-A89611-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human NSUN3 (NP_071355.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NSUN3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 38 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MLTQLKAKSEGKLAKQICKVVLDHFEKQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAAS
Target: NSUN3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000