Anti-GPB Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92190-100
Article Name: Anti-GPB Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92190-100
Supplier Catalog Number: A92190-100
Alternative Catalog Number: ABC-A92190-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 1-91 of human GPB.
Conjugation: Unconjugated
Rabbit polyclonal antibody to GPB.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 10kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
Target: GPB
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:200