Anti-DEFB132 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92205-100
Article Name: Anti-DEFB132 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92205-100
Supplier Catalog Number: A92205-100
Alternative Catalog Number: ABC-A92205-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DEFB132 (NP_997352.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to DEFB132.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Target: DEFB132
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200