Anti-ErbB3/HER3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92237-100
Article Name: Anti-ErbB3/HER3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92237-100
Supplier Catalog Number: A92237-100
Alternative Catalog Number: ABC-A92237-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 20-285 of human ErbB3/HER3.
Conjugation: Unconjugated
Rabbit polyclonal antibody to ErbB3/HER3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 185 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEP
Target: ErbB3/HER3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200