Anti-PHF17 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92251-100
Article Name: Anti-PHF17 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92251-100
Supplier Catalog Number: A92251-100
Alternative Catalog Number: ABC-A92251-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC
Species Reactivity: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 210-509 of human PHF17.
Conjugation: Unconjugated
Rabbit polyclonal antibody to PHF17.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 96kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: QSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNK
Target: PHF17
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:100