Anti-Cx40/GJA5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92272-100
Article Name: Anti-Cx40/GJA5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92272-100
Supplier Catalog Number: A92272-100
Alternative Catalog Number: ABC-A92272-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 229-358 of human GJA5 (NP_859054.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Cx40/GJA5.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Target: Cx40/GJA5
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:200