Anti-CYP11B1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92278-100
Article Name: Anti-CYP11B1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92278-100
Supplier Catalog Number: A92278-100
Alternative Catalog Number: ABC-A92278-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B1 (NP_000488.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CYP11B1.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: TVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFI
Target: CYP11B1
Antibody Type: Primary Antibody
Application Dilute: IHC: 1:100-1:500, ICC/IF: 1:50-1:200