Anti-Cadherin 9 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92372-100
Article Name: Anti-Cadherin 9 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92372-100
Supplier Catalog Number: A92372-100
Alternative Catalog Number: ABC-A92372-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 340-420 of human CDH9 (NP_057363.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Cadherin 9.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 120 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: QMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS
Target: Cadherin 9
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000