Anti-CD163L1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92378-100
Article Name: Anti-CD163L1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92378-100
Supplier Catalog Number: A92378-100
Alternative Catalog Number: ABC-A92378-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-550 of human CD163L1 (NP_777601.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CD163L1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 159 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: DCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICSDKADLDLRLVGAHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPMHVFGMTYFKEASGPIWLDDVSCIGNES
Target: CD163L1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000