Anti-CRY2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92421-100
Article Name: Anti-CRY2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92421-100
Supplier Catalog Number: A92421-100
Alternative Catalog Number: ABC-A92421-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 455-614 of human CRY2 (NP_066940.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to CRY2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 70 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: PVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Target: CRY2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, ICC/IF: 1:50-1:200