Anti-ZNF416 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92435-100
Article Name: Anti-ZNF416 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92435-100
Supplier Catalog Number: A92435-100
Alternative Catalog Number: ABC-A92435-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, IHC-P
Species Reactivity: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 495-594 of human ZNF416.
Conjugation: Unconjugated
Rabbit polyclonal antibody to ZNF416.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 67kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
Target: ZNF416
Antibody Type: Primary Antibody
Application Dilute: IHC-P: 1:50-1:200, ICC/IF: 1:50-1:200