Anti-ATG7 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92437-100
Article Name: Anti-ATG7 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92437-100
Supplier Catalog Number: A92437-100
Alternative Catalog Number: ABC-A92437-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 500-676 of human ATG7.
Conjugation: Unconjugated
Rabbit polyclonal antibody to ATG7.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 78kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
Target: ATG7
Antibody Type: Primary Antibody
Application Dilute: IHC-P: 1:50-1:100