Anti-SETD5 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A92447-100
Article Name: Anti-SETD5 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A92447-100
Supplier Catalog Number: A92447-100
Alternative Catalog Number: ABC-A92447-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC
Species Reactivity: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 520-740 of human SETD5.
Conjugation: Unconjugated
Rabbit polyclonal antibody to SETD5.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 158kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: HAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVECPLRITTDPTVLATTLNMLP
Target: SETD5
Antibody Type: Primary Antibody
Application Dilute: ICC/IF: 1:50-1:200