Anti-TANK/TRAF2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9990-100
Article Name: Anti-TANK/TRAF2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9990-100
Supplier Catalog Number: A9990-100
Alternative Catalog Number: ABC-A9990-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human TANK (NP_597841.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to TANK/TRAF2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 47 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Target: TANK/TRAF2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000