TLR2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human Toll-like receptor 2 (TLR2, also designated as CD282). TLR2 mediates immune responses by recognition of lipid-containing pathogen-associated molecular patterns (PAMPs) such as lipoteichoic acid and di- and tri-acylated cysteine-containing lipoproteins. TLR2 forms heterodimers with TLR1 or TLR6 as the initial step in a signal transduction cascade which leads to significant innate immune responses as well as development of adaptive immunity. TLR2-TLR1 heterodimers recognize triacylated lipopeptides from Gram-negative bacteria and mycoplasma, while TLR2-TLR6 heterodimers recognize diacylated lipopeptides from Gram-positive bacteria and mycoplasma. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag (Figure 2), which does not interfere with TLR2 activity as confirmed by functional assay (Figure 1). Sequence data: Human TLR2 (accession number NP_001305716) MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLN SIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSL EHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMD TFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQI SGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSL TERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTL ILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISR NAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDS PSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAW LQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPG KWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPI EKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Application Dilute:
Application:. Functional assay. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
* VAT and and shipping costs not included. Errors and price changes excepted