Claudin18.2/CHO-K1 Stable Cell Line Preis auf Anfrage
Biozol Catalog Number:
ABI-14-539ACL
Supplier Catalog Number:
14-539ACL
Alternative Catalog Number:
ABI-14-539ACL-1VIAL
Manufacturer:
Abeomics
Category:
Zellen/Zellkultur
Application:
FA
Claudin 18.2/CHO-K1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human claudin 18.2 (CLDN18.2). CLDN18.2 is a highly selective marker protein that is exclusively expressed in differentiated gastric mucosal membrane epithelial cells. Abnormal expression of CLDN18.2 has been observed during the occurence and development of various primary malignat tumors such as gastric cancer, breast cancer, colon cancer and liver cancer. CLDN18.2 has become a significant biomarker for targeted therapy in different cancers, and a monoclonal antibody against CLDN18.2 such as Anti-CLDN18.2 (zolbetuximab biosimilar, Abeomics, Cat. No.: 12-9134) is an example utilized in the immunotherapy targeting CLDN18.2. Sequence data: Human CLDN18.2 (accession number NP_001002026) MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAM LQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTA NMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGG FKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Application Dilute:
Application:. Screen for antibodies of human Claudin 18.2 through Flow Cytometry. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated F
* VAT and and shipping costs not included. Errors and price changes excepted
