DARC (Human) Recombinant Protein
Catalog Number:
ABN-H00002532-G01
| Article Name: |
DARC (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-H00002532-G01 |
| Supplier Catalog Number: |
H00002532-G01 |
| Alternative Catalog Number: |
ABN-H00002532-G01-10 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP |
| Species Reactivity: |
Human |
| Human DARC full-length ORF (NP_002027.2) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
| Tag: |
None |
| UniProt: |
2532 |
| Buffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Form: |
Liquid |
| Sequence: |
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWP |
| Target: |
DARC |
| Application Dilute: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |