LILRB1 (Human) Recombinant Protein

Catalog Number: ABN-H00010859-G01
Article Name: LILRB1 (Human) Recombinant Protein
Biozol Catalog Number: ABN-H00010859-G01
Supplier Catalog Number: H00010859-G01
Alternative Catalog Number: ABN-H00010859-G01-10
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP
Species Reactivity: Human
Human LILRB1 full-length ORF (AAH15731.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 10859
Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Form: Liquid
Sequence: MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRF
Target: LILRB1
Application Dilute: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.