OR5P2 (Human) Recombinant Protein
Catalog Number:
ABN-H00120065-G01
| Article Name: |
OR5P2 (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-H00120065-G01 |
| Supplier Catalog Number: |
H00120065-G01 |
| Alternative Catalog Number: |
ABN-H00120065-G01-2 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP |
| Species Reactivity: |
Human |
| Human OR5P2 full-length ORF (NP_703145.1) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
| Tag: |
None |
| UniProt: |
120065 |
| Buffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Form: |
Liquid |
| Sequence: |
MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLSHLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPLLELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGTITFIY |
| Target: |
OR5P2 |
| Application Dilute: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
