PPP1R1C (Human) Recombinant Protein (P02)

Catalog Number: ABN-H00151242-P02
Article Name: PPP1R1C (Human) Recombinant Protein (P02)
Biozol Catalog Number: ABN-H00151242-P02
Supplier Catalog Number: H00151242-P02
Alternative Catalog Number: ABN-H00151242-P02-10,ABN-H00151242-P02-25
Manufacturer: Abnova
Category: Proteine/Peptide
Application: AP, Array, ELISA, WB
Species Reactivity: Human
Human PPP1R1C full-length ORF ( NP_001074014.1, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 151242
Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence: MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Target: PPP1R1C