AKT1 monoclonal antibody, clone CL0887, IgG1, Clone: [CL0887], Mouse, Monoclonal
Catalog Number:
ABN-MAB15656
| Article Name: |
AKT1 monoclonal antibody, clone CL0887, IgG1, Clone: [CL0887], Mouse, Monoclonal |
| Biozol Catalog Number: |
ABN-MAB15656 |
| Supplier Catalog Number: |
MAB15656 |
| Alternative Catalog Number: |
ABN-MAB15656-100,ABN-MAB15656-25 |
| Manufacturer: |
Abnova |
| Host: |
Mouse |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to human AKT1. |
| Alternative Names: |
ABN-202409-10_Ab |
| Mouse monoclonal antibody raised against partial recombinant human AKT1. |
| Clonality: |
Monoclonal |
| Clone Designation: |
[CL0887] |
| Isotype: |
IgG1 |
| UniProt: |
207 |
| Buffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Form: |
Liquid |
| Sequence: |
ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA |
| Target: |
AKT1 |
| Application Dilute: |
Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user. |