STK11 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P10818
Article Name: STK11 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P10818
Supplier Catalog Number: P10818
Alternative Catalog Number: ABN-P10818-100
Manufacturer: Abnova
Host: E. coli
Category: Antikörper
Application: SDS-PAGE
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 1-430 of human STK11.
Human STK11 (Q15831, 1 a.a. - 430 a.a.) full-length recombinant protein expressed in Escherichia coli .
Tag: N-terminus 6xHis-SUMO tag
UniProt: 6794
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose.
Purity: >=90% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPF
Target: STK11