STK11 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P10818
| Article Name: |
STK11 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P10818 |
| Supplier Catalog Number: |
P10818 |
| Alternative Catalog Number: |
ABN-P10818-100 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Antikörper |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids 1-430 of human STK11. |
| Human STK11 (Q15831, 1 a.a. - 430 a.a.) full-length recombinant protein expressed in Escherichia coli . |
| Tag: |
N-terminus 6xHis-SUMO tag |
| UniProt: |
6794 |
| Buffer: |
Lyophilized from Tris/PBS-based buffer, 6% Trehalose. |
| Form: |
Lyophilized |
| Sequence: |
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPF |
| Target: |
STK11 |
