SLK (Human) Recombinant Protein, Yeast

Catalog Number: ABN-P10820
Article Name: SLK (Human) Recombinant Protein, Yeast
Biozol Catalog Number: ABN-P10820
Supplier Catalog Number: P10820
Alternative Catalog Number: ABN-P10820-100
Manufacturer: Abnova
Host: Yeast
Category: Antikörper
Application: SDS-PAGE
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids 34-292 of human SLK.
Human SLK (Q9H2G2, 34 a.a. - 292 a.a.) partial recombinant protein expressed in yeast.
UniProt: 9748
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose.
Form: Lyophilized
Sequence: WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQ
Target: SLK