MRC1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P10977
| Article Name: |
MRC1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P10977 |
| Supplier Catalog Number: |
P10977 |
| Alternative Catalog Number: |
ABN-P10977-100 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Antikörper |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids 655-1213 of human MRC1. |
| Human MRC1 (P22897, 655 a.a. - 1213 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Tag: |
His-SUMO tag at N-terminus |
| UniProt: |
4360 |
| Buffer: |
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity: |
>=90% as determined by SDS-PAGE. |
| Form: |
Lyophilized |
| Sequence: |
RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW |
| Target: |
MRC1 |
| Application Dilute: |
SDS-PAGE |
