SARS-CoV-2 S (438 - 479) (Human) Recombinant Protein
Catalog Number:
ABN-P6694
| Article Name: |
SARS-CoV-2 S (438 - 479) (Human) Recombinant Protein |
| Biozol Catalog Number: |
ABN-P6694 |
| Supplier Catalog Number: |
P6694 |
| Alternative Catalog Number: |
ABN-P6694-10,ABN-P6694-25 |
| Manufacturer: |
Abnova |
| Category: |
Proteine/Peptide |
| Application: |
AP, Array, ELISA, WB |
| Species Reactivity: |
Human |
| Alternative Names: |
sars-cov-2 |
| Human SARS-CoV-2 S partial ORF (YP_009724390.1, 438 a.a. - 479 a.a.) recombinant protein with GST tag at N-terminal. |
| Tag: |
GST |
| UniProt: |
43740568 |
| Buffer: |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Sequence: |
SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTP |
