IL7 (Human) Recombinant Protein, Mammal
Catalog Number:
ABN-P7387
| Article Name: |
IL7 (Human) Recombinant Protein, Mammal |
| Biozol Catalog Number: |
ABN-P7387 |
| Supplier Catalog Number: |
P7387 |
| Alternative Catalog Number: |
ABN-P7387-25 |
| Manufacturer: |
Abnova |
| Host: |
Mammal |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human IL7 (P13232, 26 a.a. - 177 a.a.) partial recombinant protein with His tag expressed in CHO cells. |
| Tag: |
His |
| NCBI: |
3574 |
| UniProt: |
3574 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNST |
| Target: |
IL7 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
| Application Notes: |
Mammalian cell (CHO) expression system |
