NOG (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P7390
Article Name: NOG (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P7390
Supplier Catalog Number: P7390
Alternative Catalog Number: ABN-P7390-10
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human NOG (Q13253, 28 a.a. - 232 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
NCBI: 9241
UniProt: 9241
Buffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Form: Lyophilized
Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Target: NOG
Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.
Application Notes: Mammalian cell (CHO) expression system