IGF1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7426
| Article Name: |
IGF1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7426 |
| Supplier Catalog Number: |
P7426 |
| Alternative Catalog Number: |
ABN-P7426-1 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human IGF1 (P05019, 53 a.a. - 118 a.a.) partial recombinant protein expressed with additional N-terminal sequence (MFPAMPLSSLFVNGPRT) expressed in Escherichia coli. |
| Tag: |
None |
| NCBI: |
3479 |
| UniProt: |
3479 |
| Buffer: |
Lyophilized from a solution in 48% acetonitrile, 0.1% TFA. Reconstitute the lyophilized powder in 10 mM HCl up to 1mg/mL. |
| Form: |
Lyophilized |
| Sequence: |
LCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCA |
| Target: |
IGF1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
| Application Notes: |
Escherichia coli expression system |
