Pdgfb (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P7428
| Article Name: |
Pdgfb (Rat) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7428 |
| Supplier Catalog Number: |
P7428 |
| Alternative Catalog Number: |
ABN-P7428-10 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Rat |
| Rat Pdgfb (Q05028, 74 a.a. - 182 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli. |
| Tag: |
None |
| NCBI: |
24628 |
| UniProt: |
24628 |
| Buffer: |
Lyophilized after extensive dialysis against 20 mM acetic acid. Reconstitute the lyophilized powder in 20 mM acetic acid up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT |
| Target: |
Pdgfb |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
| Application Notes: |
Escherichia coli expression system |
