Ntf4 (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P7429
Article Name: |
Ntf4 (Mouse) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P7429 |
Supplier Catalog Number: |
P7429 |
Alternative Catalog Number: |
ABN-P7429-10 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA, SDS-PAGE |
Species Reactivity: |
Mouse |
Mouse Ntf4 (Q80VU4, 80 a.a. - 209 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli. |
Tag: |
None |
NCBI: |
4909 |
UniProt: |
4909 |
Buffer: |
Lyophilized after extensive dialysis against 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid or ddH2O up to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA |
Target: |
NTF4 |
Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
Application Notes: |
Escherichia coli expression system |