HA (Influenza A virus H1N1) Recombinant Protein, Insect

Product Overview

• Article Name: HA (Influenza A virus H1N1) Recombinant Protein, Insect
• Biozol Catalog Number: ABN-P7430
• Supplier Catalog Number: P7430
• Alternative Catalog Number: ABN-P7430-10
• Manufacturer: Abnova
• Host: Insect
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE
• Species Reactivity: Virus

Product Description

Influenza A virus H1N1 HA (C3W5S1, 35 a.a. - 107 a.a.) partial recombinant protein with His tag expressed in Sf9 insect cells.

Product Properties

• Tag: His
• NCBI: 23308115
• UniProt: 23308115
• Buffer: Lyophilized from a solution in 20 mM PB buffer (pH 7.4), 300 mM NaCl, 5% mannitol, 5% trehalose. Reconstitute the lyophilized powder in ddH2O up to 200 ug/mL.
• Form: Lyophilized
• Sequence: DKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSS

Application Notes

• Application Dilute: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.
• Application Notes: Sf9 insect cells expression system