HGF (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P7469
| Article Name: |
HGF (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P7469 |
| Supplier Catalog Number: |
P7469 |
| Alternative Catalog Number: |
ABN-P7469-5 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Human |
| Human HGF (P14210, 23 a.a. - 99 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Tag: |
None |
| NCBI: |
3082 |
| UniProt: |
3082 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
PIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWF |
| Target: |
HGF |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
| Application Notes: |
Escherichia coli expression system |
