Ctf1 (Mouse) Recombinant Protein, Human
Catalog Number:
ABN-P7486
| Article Name: |
Ctf1 (Mouse) Recombinant Protein, Human |
| Biozol Catalog Number: |
ABN-P7486 |
| Supplier Catalog Number: |
P7486 |
| Alternative Catalog Number: |
ABN-P7486-10 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
FA, SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Ctf1 (Q60753-1, 2 a.a. - 203 a.a.) partial recombinant protein expressed in HEK293 cells. |
| Tag: |
None |
| NCBI: |
13019 |
| UniProt: |
13019 |
| Buffer: |
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O or PBS up to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA |
| Target: |
Ctf1 |
| Application Dilute: |
Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |
| Application Notes: |
Mammalian cell (HEK 293) expression system |
