Csf3 (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P8709
| Article Name: |
Csf3 (Rat) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8709 |
| Supplier Catalog Number: |
P8709 |
| Alternative Catalog Number: |
ABN-P8709-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Rat |
| Rat Csf3 recombinant protein expressed in Escherichia coli. |
| Buffer: |
Lyophilized from a solution containing 5 mM Sodium Citrate, pH 4.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
KKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI |
