Luciferase mRNA

Catalog Number: ABN-U0860
Article Name: Luciferase mRNA
Biozol Catalog Number: ABN-U0860
Supplier Catalog Number: U0860
Alternative Catalog Number: ABN-U0860-100
Manufacturer: Abnova
Category: Molekularbiologie
Luciferase mRNA is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. The sequence of Luciferase mRNA from Photinus pyralis. This product expresses firefly luciferase, which catalyzes the oxidation of the substrate D-luciferin to oxyluciferin, producing bioluminescence at a wavelength of approximately 560 nm during the oxidation of D-luciferin. Firefly luciferase is widely used as a bioluminescent reporter gene, serving as a control in studies involving target gene translation efficiency, cell viability, and in vivo imaging in mammalian cells.
Concentration: 1 mg/mL
Form: Liquid
Sequence: MEDAKNIKKGPAPRYPLEDGTAGEQLHKAMKRYAQVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSE NSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVT SHLPPGFNEYDFKPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIKPDTAILSVVPFHHGFGMFTTL
Application Dilute: The optimal working dilution should be determined by the end user.