eGFP mRNA (N1-Me-Pseudo UTP)

Catalog Number: ABN-U0861
Article Name: eGFP mRNA (N1-Me-Pseudo UTP)
Biozol Catalog Number: ABN-U0861
Supplier Catalog Number: U0861
Alternative Catalog Number: ABN-U0861-100
Manufacturer: Abnova
Category: Molekularbiologie
eGFP mRNA (N1-Me-Pseudo UTP) is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. When transfected into cells, it can express strong green fluorescence, making it suitable as a control in studies of target gene transfection and expression in mammalian cells.
Concentration: 1 mg/mL
Form: Liquid
Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHD FFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNF KIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Application Dilute: The optimal working dilution should be determined by the end user.