hEPO mRNA (N1-Me-Pseudo UTP)

Catalog Number: ABN-U0864
Article Name: hEPO mRNA (N1-Me-Pseudo UTP)
Biozol Catalog Number: ABN-U0864
Supplier Catalog Number: U0864
Alternative Catalog Number: ABN-U0864-100
Manufacturer: Abnova
Category: Molekularbiologie
hEPO mRNA (N1-Me-Pseudo UTP) is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. in vivo transfection of EPO mRNA leads to a significant increase in reticulocytes and hematocrit levels, and it is commonly used in immunological and biochemical research.
Concentration: 1 mg/mL
Tag: Flag (C-term)
Form: Liquid
Sequence: MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQ QAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFR VYSNFLRGKLKLYTGEACRTGDRDYKDDDDK
Application Dilute: The optimal working dilution should be determined by the end user.