mCherry mRNA (N1-Me-Pseudo UTP)

Product Overview

• Article Name: mCherry mRNA (N1-Me-Pseudo UTP)
• Biozol Catalog Number: ABN-U0866
• Supplier Catalog Number: U0866
• Alternative Catalog Number: ABN-U0866-100
• Manufacturer: Abnova
• Category: Molekularbiologie

Product Description

mCherry mRNA is a reporter gene mRNA encoding the red fluorescent protein mCherry, with maximum excitation and emission wavelengths of 587 nm and 610 nm.

Product Properties

• Concentration: 1 mg/mL
• Buffer: RNase free water.
• Form: Liquid
• Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPAD IPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGE IKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Application Notes

• Application Dilute: The optimal working dilution should be determined by the end user.