Cas9 mRNA

Catalog Number: ABN-U0867
Article Name: Cas9 mRNA
Biozol Catalog Number: ABN-U0867
Supplier Catalog Number: U0867
Alternative Catalog Number: ABN-U0867-100
Manufacturer: Abnova
Category: Molekularbiologie
Cas9 mRNA is a mature mRNA synthesized in vitro, featuring a 5 Cap 1 structure and a 3 poly(A) tail. It encodes the Cas9 protein, which is equipped with nuclear localization signals (NLS) at both the N- and C-termini to facilitate nuclear entry, thereby enhancing DNA cleavage efficiency. It is an ideal choice for studying transfection and expression through various assay methods.
Concentration: 1 mg/mL
Tag: NLS, Flag (C-term)
Form: Liquid
Sequence: MPKKKRKVDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNE MAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFI QLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSL
Application Dilute: The optimal working dilution should be determined by the end user.