Firefly Luciferase saRNA (5-Methyl-CTP)

Catalog Number: ABN-U0876
Article Name: Firefly Luciferase saRNA (5-Methyl-CTP)
Biozol Catalog Number: ABN-U0876
Supplier Catalog Number: U0876
Alternative Catalog Number: ABN-U0876-100
Manufacturer: Abnova
Category: Molekularbiologie
Application: FA
Firefly Luciferase is a synthetic self-amplifying RNA produced in vitro. Its replicase module, derived from Venezuelan equine encephalitis virus (VEEV), enables sustained gene amplification in mammalian systems, facilitating low-dose, high-level, and long-lasting target gene expression.
Concentration: 1 mg/mL
Buffer: 1 mM sodium citrate buffer
Form: Liquid
Sequence: MEDAKNIKKGPAPRYPLEDGTAGEQLHKAMKRYAQVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSE NSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVT SHLPPGFNEYDFKPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIKPDTAILSVVPFHHGFGMFTTL
Application Dilute: The optimal working dilution should be determined by the end user.